Luận án Nghiên cứu tạo kháng nguyên Hemagglutinin (HA) tái tổ hợp của virus cúm A/H5N1 bằng phương pháp biểu hiện tạm thời trên cây thuốc lá và đánh giá khả năng sinh miễn dịch

1. Tính cấp thiết của luận án

Cúm gia cầm thể độc lực cao (highly pathogenic avian influenza, HPAI) do

virus cúm A/H5N1 gây ra là bệnh truyền nhiễm cấp tính có tốc độ lây lan nhanh với

tỷ lệ gây chết cao trong đàn gia cầm bị bệnh. Dịch cúm gia cầm liên tục tái phát hàng

năm với tốc độ lây lan nhanh và diễn biến phức tạp. Hàng chục triệu gia cầm và thuỷ

cầm đã bị chết hoặc bị tiêu huỷ gây thiệt hại kinh tế nặng nề cho ngành chăn nuôi trên

thế giới cũng như ở Việt Nam. Đặc biệt, chủng virus cúm A/H5N1 có thể xâm nhiễm

gây bệnh ở người với tỉ lệ tử vong rất cao và đang trở thành mối đe dọa nguy hiểm

cho sức khoẻ cộng đồng.

Vaccine là một biện pháp hiệu quả bảo vệ sức khoẻ người và vật nuôi chống

lại virus cúm gia cầm A/H5N1. Tuy nhiên, sự tiến hoá của virus cúm gia cầm

A/H5N1, trong đó đáng chú ý là sự biến đổi của gen mã khoá kháng nguyên bề mặt

hemagglutinin (HA) - một trong hai kháng nguyên đích của virus cúm A/H5N1 được

sử dụng cho phát triển vaccine, có thể làm thay đổi tính kháng nguyên dẫn đến ảnh

hưởng đáp ứng miễn dịch của gia cầm khi được tiêm phòng vaccine. Tại Việt Nam,

bệnh cúm gia cầm A/H5N1 khởi phát và gây dịch cho đàn gia cầm vào năm 2003,

chủ yếu thuộc clade 1 và 2. Các clade này tiếp tục tiến hoá và phân nhánh nhỏ hơn

như clade 1.1, 1.1.1, 1.1.2, 2.3.1, 2.3.2, 2.3.4 [1]. Clade 2.3.2 phân bố phổ biến tại

Việt Nam trong giai đoạn 2009–2014 và sau đó biến đổi tiếp để tạo thành các phân

nhánh nhỏ hơn, phổ biến như clade 2.3.2.1a/b/c. Từ 2014–2017, clade 2.3.2.1c và

2.3.4.4 chiếm ưu thế và thể hiện sự tiến hóa dựa vào địa lý một cách khác biệt. Các

virus clade 2.3.2.1c phát hiện ở các vùng phía Bắc, Trung và Nam, trong khi các virus

clade 2.3.4.4 chỉ được phát hiện ở các vùng Bắc và Trung tạo thành các nhóm nhỏ.

Những virus này đã trải qua sự tái tổ hợp đa dạng với sự tồn tại của ít nhất 12 kiểu

gen và giữ lại các motif đặc trưng điển hình [2]. Sự tiến hoá phức tạp này của virus

cúm gia cầm A/H5N1 đã làm cho vaccine hiện có trở nên kém hiệu lực, công tác

phòng chống dịch bệnh cúm gia cầm ở Việt Nam ngày càng khó khăn, dịch bệnh tái

bùng phát dễ dàng. Tính từ 2003 đến nay, Việt Nam là nước được ghi nhận có số ổ

dịch cao nhất trên thế giới. Do đó, nếu chúng ta có thể chủ động được nguồn vaccine2

cập nhật nhất cũng như có tính bảo hộ phổ rộng và lâu dài sẽ giúp giảm chi phí cho

sản xuất, kinh doanh và chủ động đáp ứng nhanh nhu cầu khi có các biến chủng virus

mới xuất hiện tại Việt Nam.

Trước vấn đề cấp thiết đó đòi hỏi quá trình nghiên cứu và sản xuất vaccine cần

được rút ngắn, tăng quy mô sản xuất, giảm công sức và chi phí để cung cấp kịp thời

một lượng lớn vaccine cúm trên diện rộng. Mô hình sản xuất kháng nguyên HA tái

tổ hợp bằng phương pháp biểu hiện tạm thời ở thực vật thông qua vi khuẩn

Agrobacterium tumefaciens (agroinfiltration) đang được xem là một giải pháp hữu

hiệu, đơn giản, an toàn và có thể cho phép sản xuất vaccine với số lượng lớn và nhanh

chóng (1–2 tháng) đáp ứng kịp thời khi dịch bệnh xảy ra. Mô hình này đã được nhóm

nghiên cứu của TS. Phan Trọng Hoàng và cộng sự tại Viện nghiên cứu di truyền và

cây trồng thực vật CHLB Đức nghiên cứu với nhiều thành công trong việc tạo ra các

kháng nguyên HA dạng monomer và trimer có và không có ELP hoá hay các dạng

HA oligomer. Dạng trimer của HA đã được chứng minh là giúp tăng cường đáp ứng

miễn dịch hơn so với dạng HA monomer. HA trimer đã tạo ra các kháng thể trung

hòa có khả năng tương tác với cả các hạt có cấu trúc giống virus đồng dạng từ thực

vật và virus cúm A/H5N1 dị chủng đã bị bất hoạt. Đáng chú ý, việc dung hợp ELP

vào kháng nguyên HA trimer không ảnh hưởng tới quá trình trimer hóa hay tính sinh

miễn dịch của HA, nó làm tăng cường mức độ biểu hiện mạnh mẽ của protein HA

trimer được ELP hóa. Đặc biệt, các HA trimer ELP hóa có thể được tinh sạch dễ dàng

bằng quy trình mITC với tiềm năng có thể mở rộng quy mô sản xuất [3]. Nhóm nghiên

cứu cũng đã chứng minh HA dạng oligomer được tạo thành từ các HA dạng trimer

trong thực vật dựa vào tương tác đặc hiệu của S·Protein và S·Tag có hoạt tính sinh

miễn dịch tốt hơn so với dạng HA trimer [4].

Căn cứ vào tình hình thực tiễn và các luận cứ khoa học trên, đề tài “Nghiên

cứu tạo kháng nguyên hemagglutinin (HA) tái tổ hợp của virus cúm A/H5N1

bằng phương pháp biểu hiện tạm thời trên cây thuốc lá và đánh giá khả năng

sinh miễn dịch” đã được lựa chọn cho luận án này.

pdf 182 trang chauphong 16/08/2022 120
Bạn đang xem 20 trang mẫu của tài liệu "Luận án Nghiên cứu tạo kháng nguyên Hemagglutinin (HA) tái tổ hợp của virus cúm A/H5N1 bằng phương pháp biểu hiện tạm thời trên cây thuốc lá và đánh giá khả năng sinh miễn dịch", để tải tài liệu gốc về máy hãy click vào nút Download ở trên

Tóm tắt nội dung tài liệu: Luận án Nghiên cứu tạo kháng nguyên Hemagglutinin (HA) tái tổ hợp của virus cúm A/H5N1 bằng phương pháp biểu hiện tạm thời trên cây thuốc lá và đánh giá khả năng sinh miễn dịch

Luận án Nghiên cứu tạo kháng nguyên Hemagglutinin (HA) tái tổ hợp của virus cúm A/H5N1 bằng phương pháp biểu hiện tạm thời trên cây thuốc lá và đánh giá khả năng sinh miễn dịch
BỘ GIÁO DỤC VÀ ĐÀO TẠO VIỆN HÀN LÂM KHOA HỌC 
VÀ CÔNG NGHỆ VIỆT NAM 
HỌC VIỆN KHOA HỌC VÀ CÔNG NGHỆ 
----------------------------- 
Phạm Thị Vân 
NGHIÊN CỨU TẠO KHÁNG NGUYÊN 
HEMAGGLUTININ (HA) TÁI TỔ HỢP CỦA VIRUS CÚM 
A/H5N1 BẰNG PHƯƠNG PHÁP BIỂU HIỆN TẠM THỜI 
TRÊN CÂY THUỐC LÁ VÀ ĐÁNH GIÁ KHẢ NĂNG SINH 
MIỄN DỊCH 
LUẬN ÁN TIẾN SĨ SINH HỌC 
Hà Nội – 2021 
BỘ GIÁO DỤC VÀ ĐÀO TẠO VIỆN HÀN LÂM KHOA HỌC 
VÀ CÔNG NGHỆ VIỆT NAM 
HỌC VIỆN KHOA HỌC VÀ CÔNG NGHỆ 
----------------------------- 
Phạm Thị Vân 
NGHIÊN CỨU TẠO KHÁNG NGUYÊN 
HEMAGGLUTININ (HA) TÁI TỔ HỢP CỦA VIRUS CÚM 
A/H5N1 BẰNG PHƯƠNG PHÁP BIỂU HIỆN TẠM THỜI 
TRÊN CÂY THUỐC LÁ VÀ ĐÁNH GIÁ KHẢ NĂNG SINH 
MIỄN DỊCH 
 Chuyên ngành: Công nghệ sinh học 
 Mã số: 9 42 02 01 
LUẬN ÁN TIẾN SĨ SINH HỌC 
 NGƯỜI HƯỚNG DẪN KHOA HỌC: 
 1. TS. Vũ Huyền Trang 
 2. GS. TS. Lê Thanh Hoà 
Hà Nội – 2021 
i 
LỜI CẢM ƠN 
Tôi xin bày tỏ lòng biết ơn sâu sắc tới thầy cô giáo, TS. Vũ Huyền Trang và 
GS.TS. Lê Thanh Hoà đã tận tình hướng dẫn, chỉ bảo, dìu dắt, giúp đỡ tôi thực hiện 
và hoàn thành luận án. 
Tôi xin bày tỏ lòng biết ơn sâu sắc tới PGS.TS. Chu Hoàng Hà, PGS. TS. Phạm 
Bích Ngọc, Ths. Hồ Thị Thương, ThS. Nguyễn Thu Giang, KTV. Trần Thị Loan cùng 
tập thể cán bộ Phòng Công nghệ Tế bào thực vật, phòng công nghệ ADN ứng dụng, 
Viện Công nghệ sinh học đã tạo điều kiện làm việc, hỗ trợ kinh phí, nhiệt tình giúp 
đỡ và truyền đạt nhiều kinh nghiệm quý báu cho tôi trong suốt thời gian thực hiện và 
hoàn thành luận án. 
Đặc biệt tôi xin bày tỏ lòng biết ơn sâu sắc tới GS. TS. Udo Conrad, TS. Phan 
Trọng Hoàng, Viện nghiên cứu di truyền và cây trồng thực vật (IPK) CHLB Đức đã 
truyền đạt những kiến thức và kinh nghiệm quý báu, giúp đỡ tôi trong suốt thời gian 
thực tập tại Viện IPK cũng như trong thời gian tôi học tập tại Việt Nam. 
Tôi xin cảm ơn sâu sắc tới TS. Trần Xuân Hạnh Công ty CP thuốc thú y Ttrung 
ương NAVETCO đã giúp đỡ tôi thực hiện thành công các thí nghiệm công cường độc 
trên gà. 
Tôi xin chân thành cảm ơn Bộ Khoa học và Công nghệ Việt Nam với đề tài 
Nghị định thư mã số NĐT.07.GER.15 và Bộ giáo dục và nghiên cứu CHLB Đức với 
đề tài “Plantfluvac” mã số 031A283 đã hỗ trợ kinh phí cho tôi thực hiện các nghiên 
cứu trong luận án này. 
Tôi xin cũng bày tỏ lòng biết ơn sâu sắc tới Bộ phận Đào tạo, các phòng chức 
năng và Ban lãnh đạo Viện Công nghệ sinh học, Học viện Khoa học và Công nghệ, 
Viện Hàn lâm Khoa học và Công nghệ Việt Nam đã tạo mọi điều kiện thuận lợi cho 
tôi trong quá trình học tập và bảo vệ luận án. 
Cuối cùng, tôi xin dành lòng biết ơn sâu sắc tới những người thân trong gia 
đình, bạn bè đã luôn bên tôi, động viên và góp ý cho tôi trong suốt quá trình thực hiện 
luận án. 
Tôi xin chân thành cảm ơn tất cả những sự giúp đỡ quý báu đó! 
Hà Nội, ngày tháng năm 2021 
 Nghiên cứu sinh 
 Phạm Thị Vân 
ii 
LỜI CAM ĐOAN 
Tôi xin cam đoan: 
Đây là công trình nghiên cứu của tôi, các số liệu và kết quả trình bày trong 
luận án là trung thực, đã được công bố trên các tạp chí khoa học chuyên ngành với sự 
đồng ý và cho phép của các đồng tác giả. 
Hà Nội, ngày tháng năm 2021 
 Nghiên cứu sinh 
 Phạm Thị Vân 
iii 
MỤC LỤC 
LỜI CẢM ƠN........................................................................................................................ i 
LỜI CAM ĐOAN ................................................................................................................. ii 
MỤC LỤC ........................................................................................................................... iii 
DANH MỤC CÁC TỪ VIẾT TẮT .................................................................................... vi 
DANH MỤC CÁC BẢNG ................................................................................................. vii 
DANH MỤC CÁC HÌNH ................................................................................................. viii 
MỞ ĐẦU ............................................................................................................................... 1 
1. Tính cấp thiết của luận án ...................................................................................... 1 
2. Mục tiêu nghiên cứu của luận án ........................................................................... 2 
3. Các nội dung nghiên cứu chính của luận án ......................................................... 3 
Chương 1. TỔNG QUAN TÀI LIỆU ................................................................................. 4 
1.1. Virus cúm A/H5N1 ................................................................................................... 4 
1.1.1. Phân loại và đặc tính của virus cúm A/H5N1 ...................................................... 4 
1.1.2. Cấu trúc, chức năng hệ gen của virus cúm A ...................................................... 6 
1.1.3. Cấu trúc, chức năng của protein hemagglutinin .................................................. 8 
1.1.4. Biến đổi thành phần hemagglutinin tạo nên các clade của virus A/H5N1 ........ 13 
1.2. Bệnh cúm gia cầm .................................................................................................. 16 
1.2.1. Lịch sử và tình hình dịch cúm A/H5N1 trên thế giới ........................................ 16 
1.2.2. Tình hình bệnh cúm A/H5N1 ở Việt Nam......................................................... 17 
1.3. Vaccine phòng bệnh cúm cho gia cầm ................................................................. 22 
1.3.1. Vaccine phòng bệnh cúm gia cầm trên thế giới ................................................. 23 
1.3.2. Vaccine phòng bệnh cúm gia cầm tại Việt Nam................................................ 24 
1.3.3. Nghiên cứu vaccine cúm phổ rộng .................................................................... 27 
1.3.4. Nghiên cứu vaccine từ thực vật ......................................................................... 29 
1.3.5. Nghiên cứu vaccine dựa vào HA ELP hoá ........................................................ 33 
1.3.6. Nghiên cứu vaccine dựa vào HA oligomer hoá ................................................. 34 
1.4. Hệ thống biểu hiện protein tái tổ hợp tạm thời ở thực vật thông qua 
Agrobacterium (agroinfiltration) .......................................................................... 36 
1.4.1. Nguyên lý ........................................................................................................... 36 
1.4.2. Ứng dụng agroinfiltration trong nghiên cứu và sản xuất protein có hoạt tính 
sinh học trên thế giới ......................................................................................... 37 
1.4.3. Tình hình nghiên cứu và sản xuất protein có hoạt tính sinh học thông qua 
agroinfiltration ở Việt Nam ............................................................................... 40 
Chương 2. VẬT LIỆU VÀ PHƯƠNG PHÁP NGHIÊN CỨU ....................................... 44 
2.1. Vật liệu .................................................................................................................... 44 
2.1.1. Nguồn vật liệu thực vật ...................................................................................... 44 
iv 
2.1.2. Chủng vi sinh vật, plasmid, trình tự gen ............................................................ 44 
2.1.3. Các cặp mồi sử dụng .......................................................................................... 45 
2.1.4. Nguồn vật liệu động vật ..................................................................................... 45 
2.1.5. Hóa chất ............................................................................................................. 45 
2.1.6. Thiết bị ............................................................................................................... 45 
2.1.7. Môi trường và đệm ............................................................................................ 46 
2.2. Phương pháp........................................................................................................... 46 
2.2.1. Phương pháp lựa chọn gen mã hoá kháng nguyên HA của các chủng virus 
cúm A/H5N1 ..................................................................................................... 46 
2.2.2. Phương pháp sử dụng trong thiết kế cấu trúc vector biểu hiện ở thực vật 
mang gen mã hoá kháng nguyên HA và đánh giá sự biểu hiện tạm thời 
kháng nguyên HA của virus cúm A/H5N1 trên cây thuốc lá ............................ 48 
2.2.3. Phương pháp tinh sạch, đánh giá trạng thái oligomer hoá và hoạt tính ngưng 
kết hồng cầu của các kháng nguyên HA tái tổ hợp ........................................... 55 
2.2.4. Phương pháp đánh giá khả năng gây đáp ứng miễn dịch của kháng nguyên 
HA tái tổ hợp trên động vật thí nghiệm ............................................................. 57 
Chương 3. KẾT QUẢ NGHIÊN CỨU ............................................................................. 62 
3.1. Lựa chọn gen mã hoá kháng nguyên HA của các chủng virus cúm 
A/H5N1.. ............................................................................................................. 62 
3.1.1. Thu thập và phân loại trình tự HA theo từng năm ............................................. 62 
3.1.2. Phân tích đổi mã gen và tổng hợp nhân tạo chuỗi gen mã hóa kháng nguyên 
HA của chủng virus cúm A/H5N1 trên cơ sở những trình tự đã biến đổi ......... 63 
3.1.3. Thiết kế trình tự HA COBRA đại diện các chủng virus cúm A/H5N1 quan 
tâm ..................................................................................................................... 67 
3.1.4. Chuyển đổi các trình tự amino acid của kháng nguyên HACOBRA1 và 
HACOBRA2 thành các trình tự nucleotide ....................................................... 71 
3.1.5. Phân tích và so sánh trình tự của các protein HA lựa chọn trong nghiên 
cứu ................................................................................................................. 72 
3.2. Thiết kế các cấu trúc vector biểu hiện ở thực vật mang gen mã hoá kháng 
nguyên HA và đánh giá sự biểu hiện tạm thời kháng nguyên HA của virus 
cúm A/H5N1 trên cây thuốc lá ............................................................................. 74 
3.2.1. Thiết kế vector biểu hiện kháng nguyên HA trimer .......................................... 76 
3.2.2. Thiết kế v ... ....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized GTCATATATTGTTGAGAAGGCCAATCCAGCAAACGATCTTTGCTATCCCGGAAATTTTAACGATTATGAG 350 
 S Y I V E K A N P A N D L C Y P G N F N D Y E 
 360 370 380 390 400 410 420 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized GAATTGAAACACTTGCTTTCAAGAATTAATCACTTTGAAAAAATTCAGATCATTCCTAAGGATTCTTGGT 420 
 E L K H L L S R I N H F E K I Q I I P K D S W 
 430 440 450 460 470 480 490 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized CTGACCATGAGGCTAGTTTGGGTGTGTCCGCCGCTTGCTCTTACCAGGGTAATAGCTCATTCTTCAGGAA 490 
 S D H E A S L G V S A A C S Y Q G N S S F F R N 
 500 510 520 530 540 550 560 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized TGTTGTTTGGTTGATTAAGAAGGACAATGCGTACCCTACCATTAAAAAAGGCTACAATAACACTAATAGG 560 
 V V W L I K K D N A Y P T I K K G Y N N T N R 
 570 580 590 600 610 620 630 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized GAGGATCTGTTGATACTATGGGGTATTCATCACCCAAATGATGAGGCTGAACAAACAAGGCTATACCAAA 630 
 E D L L I L W G I H H P N D E A E Q T R L Y Q 
 640 650 660 670 680 690 700 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized ACCCAACTACTTATATCTCCATAGGCACCAGTACGCTTAATCAACGCCTCGTGCCTAAAATAGCAACCAG 700 
 N P T T Y I S I G T S T L N Q R L V P K I A T R 
 710 720 730 740 750 760 770 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized ATCAAAGATTAATGGCCAGTCAGGACGGATCGACTTCTTTTGGACAATTCTAAAGCCTAACGACGCAATC 770 
 S K I N G Q S G R I D F F W T I L K P N D A I 
 780 790 800 810 820 830 840 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized CACTTTGAGAGTAATGGCAATTTCATCGCTCCCGAATACGCGTATAAGATTGTAAAGAAAGGTGATTCCA 840 
 H F E S N G N F I A P E Y A Y K I V K K G D S 
 850 860 870 880 890 900 910 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized CTATCATGAGATCAGAGGTTGAGTATGGAAACTGTAACACGCGCTGTCAGACACCAATAGGCGCCATAAA 910 
 T I M R S E V E Y G N C N T R C Q T P I G A I N 
 920 930 940 950 960 970 980 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized TAGTTCTATGCCGTTCCATAATATCCATCCTCTTACCATAGGGGAGTGTCCGAAGTACGTGAAGTCTAAT 980 
 S S M P F H N I H P L T I G E C P K Y V K S N 
 990 1000 1010 1020 1030 1040 1050 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized AAGTTGGTCCTGGCTACGGGACTTCGAAACTCCCCTCAAAGAGAGCGTAGGGGATTATTTGGCGCAATCG 1050 
 K L V L A T G L R N S P Q R E R R G L F G A I 
 1060 1070 1080 1090 1100 1110 1120 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized CTGGTTTCATCGAAGGTGGTTGGCAAGGAATGGTCGATGGATGGTATGGGTACCATCATAGTAATGAACA 1120 
 A G F I E G G W Q G M V D G W Y G Y H H S N E Q 
 1130 1140 1150 1160 1170 1180 1190 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized GGGTTCGGGATACGCTGCCGACAAAGAAAGCACTCAAAAAGCTATTGATGGAGTAACAAACAAAGTTAAC 1190 
 G S G Y A A D K E S T Q K A I D G V T N K V N 
 1200 1210 1220 1230 1240 1250 1260 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized AGTATAATTGATAAAATGAACACACAATTTGAAGCTGTTGGGCGTGAATTTAATAACCTTGAGCGAAGAA 1260 
 S I I D K M N T Q F E A V G R E F N N L E R R 
 1270 1280 1290 1300 1310 1320 1330 
P18 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized TTGAGAACCTGAATAAGAAGATGGAGGATGGATTTCTCGATGTTTGGACTTACAATGCCGAGCTGTTGGT 1330 
 I E N L N K K M E D G F L D V W T Y N A E L L V 
 1340 1350 1360 1370 1380 1390 1400 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized CCTGATGGAAAACGAAAGGACATTGGATTTCCATGATTCTAATGTCAAGAATTTATATGATAAAGTTAGA 1400 
 L M E N E R T L D F H D S N V K N L Y D K V R 
 1410 1420 1430 1440 1450 1460 1470 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized CTTCAGCTCAAGGATAATGCAAAGGAGTTGGGGAACGGCTGCTTTGAATTTTATCACAAGTGTAATAACG 1470 
 L Q L K D N A K E L G N G C F E F Y H K C N N 
 1480 1490 1500 1510 1520 1530 1540 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized AATGTATGGAGTCTGTGCGTAATGGTACCTATGATTACCCACAGTATTCGGAAGAAGCACGGCTAAAAAG 1540 
 E C M E S V R N G T Y D Y P Q Y S E E A R L K R 
 1550 1560 1570 1580 1590 1600 1610 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized GGAAGAGATTTCTGGTGTCAAGCTCGAAAGCATTGGTATCTACCAGATACTTTCTATTTATTCAACGGTT 1610 
 E E I S G V K L E S I G I Y Q I L S I Y S T V 
 1620 1630 1640 1650 1660 1670 1680 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA2 codon optimized GCTTCGTCCCTCGTGCTTGCTATTATGATGGCAGGATTGTCATTGTGGATGTGTTCCAATGGTAGTCTTC 1680 
 A S S L V L A I M M A G L S L W M C S N G S L 
 1690 1700 
 ....|....|....|....|....|... 
HACOBRA2 codon optimized AATGTAGAATTTGTATTTAGgcggccgc 1708 
 Q C R I C I * A A 
Hình P 8. Trình tự đổi gen HACOBRA2 đã tối ưu mã biểu hiện trong thuốc lá 
N. benthamiana. 
 10 20 30 40 50 60 70 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA1 MEKIVLLFAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVRPLILRD 70 
HACOBRA_clade1.1 ...................................................................... 70 
HACOBRA_clade1.1.1 ........V..N..................................................I....... 70 
HACOBRA_clade1.1.2 ...................................................................... 70 
 80 90 100 110 120 130 140 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA1 CSVAGWLLGNPMCDEFINVPEWSYIVEKANPVNDLCYPGVFNDYEELKHLLSRINHFEKIQIIPKSSWPS 140 
HACOBRA_clade1.1 ...................................................................... 140 
HACOBRA_clade1.1.1 ...................................................................... 140 
HACOBRA_clade1.1.2 ...................................................................... 140 
 150 160 170 180 190 200 210 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA1 HEASLGVSAACPYQGQSSFFRNVVWLIKKNSTYPTIKRSYNNTNQEDLLVMWGIHHPNDAAEQTKLYQNP 210 
HACOBRA_clade1.1 ...............K...................................................... 210 
HACOBRA_clade1.1.1 ...............K...........................G.......................... 210 
HACOBRA_clade1.1.2 ...................................................................... 210 
 220 230 240 250 260 270 280 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA1 TTYISVGTSTLNQRLTPRIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKGDSTI 280 
HACOBRA_clade1.1 ...................................................................... 280 
HACOBRA_clade1.1.1 ...................................................................... 280 
HACOBRA_clade1.1.2 ...................................................................... 280 
 290 300 310 320 330 340 350 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA1 MKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQREGRRKKRGLFG 350 
HACOBRA_clade1.1 ...................................................................... 350 
HACOBRA_clade1.1.1 ...................................................................... 350 
HACOBRA_clade1.1.2 .R..........................................T...............E......... 350 
 360 370 380 390 400 410 420 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA1 AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLE 420 
HACOBRA_clade1.1 ...................................................................... 420 
HACOBRA_clade1.1.1 ...................................................................... 420 
HACOBRA_clade1.1.2 ...................................................................... 420 
 430 440 450 460 470 480 490 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA1 RRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKC 490 
HACOBRA_clade1.1 ...................................................................... 490 
HACOBRA_clade1.1.1 ...................................................................... 490 
HACOBRA_clade1.1.2 ...................................................................... 490 
 500 510 520 530 540 550 560 
 ....|....|....|....|....|....|....|....|....|....|....|....|....|....| 
HACOBRA1 DNECMESVRNGTYDYPQYSEEARLKREEISGVKLESIGVYQILSIYSTVASSLALAIMVAGLSLWMCSNG 560 
HACOBRA_clade1.1 ...................................................................... 560 
HACOBRA_clade1.1.1 ...................................................................... 560 
HACOBRA_clade1.1.2 ...................................................................... 560 
 ....|.... 
HACOBRA1 SLQCRICI- 568 
HACOBRA_clade1.1 ........X 569 
HACOBRA_clade1.1.1 ........X 569 
HACOBRA_clade1.1.2 ........- 568 
Hình P 9. Hình ảnh so sánh để thiết kế nên trình tự protein HACOBRA1 đại 
diện cho các chủng virus thuộc subclade 1.1, 1.1.1 và 1.1.2. 
P19 
Bảng P 2. Hệ số tương đồng giữa các trình tự protein HA tự nhiên và nhân 
tạo 
P20 
Phụ lục 4. Phát hiện IgY đặc hiệu H5HT trong dịch chiết thô bằng Western blot 
Các phản ứng miễn dịch đặc hiệu được tạo ra bởi H5HT trimer và oligomer 
TP trong chiết xuất thô thực vật ở trên gà. Liên kết đặc hiệu H5 của các kháng thể từ 
hỗn hợp của 12 huyết thanh gà chống lại các chất chiết xuất từ thực vật tương ứng 
được phát hiện bởi Western blot. Để phát hiện kháng thể IgY đặc hiệu với các dạng 
chiết xuất thực vật khác nhau và vaccine NAVET-VIFLUVAC thương mại 
( 700 ng H5TG tinh khiết từ 
SEC protein được tách ra trên 6 làn của gel SDS-PAGE biến tính (10% 
polyacrylamide) và chuyển sang màng nitrocellulose. Màng được chặn bằng sữa bột 
không béo 5% (w/v) được hòa tan trong dung dịch đệm PBS trong 2 giờ. Sau đó, mỗi 
làn của màng được phân lập bằng cách cắt và ủ ở nhiệt độ phòng trong 90 phút với 
sự pha loãng 1:20 của hỗn hợp huyết thanh từ mười hai con gà của mỗi nhóm sau khi 
tiêm lần thứ hai. Các màng này được ủ với độ pha loãng 1: 5000 của kháng thể thứ 
hai Anti-chicken IgY (whole molecule) Alkaline phosphatase trong 1 giờ ở nhiệt độ 
phòng. Các tín hiệu cụ thể được phát hiện bằng cách ủ màng với 3,3– 
diaminobenzidine (DAB, Thermo Scientific Pierce) hòa tan trong 0,05 M Tris – HCl 
và 0,04% hydrogen peroxide trong 10 phút trong bóng tối. 

File đính kèm:

  • pdfluan_an_nghien_cuu_tao_khang_nguyen_hemagglutinin_ha_tai_to.pdf
  • pdf02_HV_Tóm tắt luận án_Tiếng Anh.pdf
  • pdf03_HV_Tóm tắt luận án_Tiếng Việt.pdf
  • doc04_HV_Đóng góp mới.doc
  • pdf04_HV_Đóng góp mới.pdf
  • doc06_HV_Trích yếu luận án.doc
  • pdf06_HV_Trích yếu luận án.pdf